General Information

  • ID:  hor002566
  • Uniprot ID:  Q6TUI8
  • Protein name:  As-NLP-13-6
  • Gene name:  NA
  • Organism:  Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ascaris (genus), Ascarididae (family), Ascaridoidea (superfamily), Ascaridomorpha (infraorder), Spirurina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  SDAFSRNFMNF
  • Length:  11(55-65)
  • Propeptide:  DRNFMNFGKRESQFSRDFLNFGKRESSVRSLKQYYDDLRQKKDFDRDFMHFGKRSDAFSRNFMNFGKRDDAFSRDFLSFGKRR
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6TUI8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002566_AF2.pdbhor002566_ESM.pdb

Physical Information

Mass: 151399 Formula: C59H82N16O18S
Absent amino acids: CEGHIKLPQTVWY Common amino acids: F
pI: 6.34 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -40.91 Boman Index: -3062
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 9.09
Instability Index: 1049.09 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21524146
  • Title:  Discovery of Neuropeptides in the Nematode Ascaris Suum by Database Mining and Tandem Mass Spectrometry